DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG31199

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:314 Identity:53/314 - (16%)
Similarity:109/314 - (34%) Gaps:83/314 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLVLAIATVSADI------------LRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQV-- 55
            |||:|.:.....::            ..:|..::.:.:.|:|:            .:|:..::  
  Fly     6 AVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPT------------EHQWVARIVY 58

  Fly    56 GLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYY---------------------GSTV 99
            |..|:.......|.|.:::...||..|||....:.|...:                     |..|
  Fly    59 GKGFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCV 123

  Fly   100 RTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTP-SVTFTVSINKIALPAIASSYSTYAGQTA 163
            |.|.::|    .::...|..|::.||:|.::::... ......::..|.:|..:....|...||.
  Fly   124 RPSQEIK----LAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICMPPPSLLNETLVAQTF 184

  Fly   164 VASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVIC--------------VESI 214
            |.:|.....|..:....|       .::...||....:.|.:|..:|              :..:
  Fly   185 VVAGLRVFEDFRLKTWVN-------TLSRGFCQSKVKTLVTSSNTVCGYHKQPVAYYLGAPLVGL 242

  Fly   215 NKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQS 268
            .||        |.:..|..|:|:  .:..:.......:.|..:.:|:|:|:..|
  Fly   243 QKK--------GHVTQNYYLVGI--MIDWRWENNRIMSSFLAIRNYMDFIRQNS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 44/262 (17%)
Tryp_SPc 40..267 CDD:238113 45/264 (17%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 42/242 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.