DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG4053

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:241 Identity:66/241 - (27%)
Similarity:102/241 - (42%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IDGRITNGNKAAANQFPYQVGLSFKSSAGSWW----CGGSIIANTWVLTAAHCTKGAS--SVTIY 94
            :|.||..|.:|.....||||.:.      :.|    |.|.|:...|:|||.||....|  .:.|.
  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQ------TIWKTHICSGVILNEQWILTAGHCALDFSIEDLRII 89

  Fly    95 YGSTVRTSAKLK--KKVSSSKFVQHAGYNAA-TLRNDISLIK-TPSVTFTVSINKIALPAIASSY 155
            .|    |:.:|:  :.:...:.:.|..|:.. ...|||:||. ..|:.|......:.|    |..
  Fly    90 VG----TNDRLEPGQTLFPDEALVHCLYDIPYVYNNDIALIHVNESIIFNDRTQIVEL----SRE 146

  Fly   156 STYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFG-SSVVTSGVICVESINKKST 219
            ...||.|...:||| ..:||......||.....:|.:..|::.:. ...:..|.||..:...:..
  Fly   147 QPPAGSTVTLTGWG-APESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGEGA 210

  Fly   220 CQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265
            |.|||||||....:|:|:.::  .:.|....|..:.....|.|||:
  Fly   211 CSGDSGGPLMWEGKLVGLVNW--GRACGVGMPDMYANTVYYQDWIR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 63/235 (27%)
Tryp_SPc 40..267 CDD:238113 64/237 (27%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 63/235 (27%)
Tryp_SPc 35..256 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.