DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG17477

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:115/281 - (40%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWC 68
            |...:|..:::..|:|               :::..|..|..||....||||  |.::..||..|
  Fly     6 FLFYILVFSSLYCDLL---------------ALEHFIVGGQNAAEGDAPYQV--SLQTLLGSHLC 53

  Fly    69 GGSIIANTWVLTAAHCTKG---------------ASSVTIYYGSTVRTSAKLKKKVSSSKFVQHA 118
            ||:||::.|::||.||.||               |....:||...:               ..|.
  Fly    54 GGAIISDRWIITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAI---------------YLHC 103

  Fly   119 GYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNL 182
            .|::...:|||.|:. ..|:||......:.||  .|.:...|.: .|.:|||..|.:. ::.:.|
  Fly   104 NYDSPKYQNDIGLLHLNESITFNALTQAVELP--TSPFPRGASE-LVFTGWGSQSAAG-SLPSQL 164

  Fly   183 QYAQFQVITNAVCQKTFGS-SVVTSGV--ICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSK 244
            |..|.|.:.:..|:....: ..:..|.  ||.........|.|||||||.....|:|:.:|... 
  Fly   165 QRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTLVGILNFFVP- 228

  Fly   245 GCEKNAPAGFTRVTSYLDWIK 265
             |.:..|..|..:..|.||::
  Fly   229 -CAQGVPDIFMNIMYYRDWMR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/243 (28%)
Tryp_SPc 40..267 CDD:238113 69/245 (28%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 69/245 (28%)
Tryp_SPc 27..246 CDD:214473 67/241 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.