DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG31326

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:284 Identity:64/284 - (22%)
Similarity:120/284 - (42%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DILRQDTPVHPRDSSAVPSIDGR--------ITNGNKAAANQFPYQVGL--SFKSSAGSWWCGGS 71
            |::.|..|    .|:.:|.  ||        |..|......|.|:.|.:  ..:|:..::.|||:
  Fly   249 DLVPQQNP----SSNGIPC--GRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGT 307

  Fly    72 IIANTWVLTAAHCTKG------ASSVTIYYGS---TVRTSAKLKKKVSSSKFVQHAGYNAATLRN 127
            :|:.:.||:||||.:.      ||.:.:..|.   .:.:..:.:   ..|:.:.|..:.......
  Fly   308 LISTSTVLSAAHCFRAPGRDLPASRLAVSLGRNTLAIHSDGEFR---GVSQLIIHENFQFKQFTE 369

  Fly   128 -DISLIKTPS-VTFTVSINKIALPAIASSYSTYAGQTAVASGWG----RTSDSSIAVATNLQYAQ 186
             |::|::... |.:|..|..|.|.:.::......|..:..:|||    .|.::.::..|:|    
  Fly   370 ADLALVRLDEPVRYTDYIVPICLWSTSNRMDLPQGLKSYVAGWGPDETGTGNTEVSKVTDL---- 430

  Fly   187 FQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKG------ 245
             .:::.|.|.......:|....:|.:... ...|..|.||||.|..:.:.|...|.|.|      
  Fly   431 -NIVSEANCALELPHVLVQPSSLCAKKTG-AGPCASDGGGPLMLREQDVWVLRGVISGGVINEKE 493

  Fly   246 --CEKNAPAGFTRVTSYLDWIKNQ 267
              ||.:.|:.||.|..:::|::.:
  Fly   494 NTCELSKPSVFTDVAKHIEWVRQK 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 57/257 (22%)
Tryp_SPc 40..267 CDD:238113 57/251 (23%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 56/248 (23%)
Tryp_SPc 277..514 CDD:214473 55/245 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.