DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG9649

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:310 Identity:70/310 - (22%)
Similarity:106/310 - (34%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VHPRDSSAVPS------------IDGR--------ITNGNKAAANQFPY------QVGLSFKSSA 63
            |||.::.|..|            |.||        |.||.:....|.|:      .||..:    
  Fly   222 VHPSNTPAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDY---- 282

  Fly    64 GSWWCGGSIIANTWVLTAAHC-----------------------------TKGASSVTIY--YGS 97
             ::.|||::|:...|::||||                             |.|.:.:.|:  |..
  Fly   283 -NFLCGGTLISARTVISAAHCFRFGSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNP 346

  Fly    98 TVRTSAKLKKKVSSSKFVQHAGY-NAATLRNDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQ 161
            .|.|.|.| ..:..|..|....| ....|.|:..|::.||                       |.
  Fly   347 NVYTDADL-ALLQLSNHVDIGDYIKPICLWNENFLLELPS-----------------------GH 387

  Fly   162 TAVASGWGRTSDSSIAVATNLQYAQF---QVITNAVCQKTF---GSSVVTSGVICVESINKKSTC 220
            .:..:|||.....:    .|.:.|:.   .:||...|:...   .:..:||..||..:......|
  Fly   388 KSYVAGWGEDEKGN----RNTRLAKMTDTDIITQWECRGNLSEENAKFITSHTICASNAQASGPC 448

  Fly   221 QGDSGGPLALNNRLIGVTSFVSSKG------CEKNAPAGFTRVTSYLDWI 264
            .|||||.|.|..:.|.:...|.|.|      |....|..:|.|..:::|:
  Fly   449 SGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAKHIEWL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 62/282 (22%)
Tryp_SPc 40..267 CDD:238113 62/275 (23%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 61/273 (22%)
Tryp_SPc 259..497 CDD:214473 60/270 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471102
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.