DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and MP1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001303421.1 Gene:MP1 / 40541 FlyBaseID:FBgn0027930 Length:400 Species:Drosophila melanogaster


Alignment Length:284 Identity:76/284 - (26%)
Similarity:128/284 - (45%) Gaps:42/284 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSF--KSSAGSWWCGGSIIANTWVLTAA 82
            |..|.:.|...:...:...|:..||:....:||:...:.:  ..:.....||||:|.:.:|||||
  Fly   118 RSGTKLLPMAPNCGENFGDRVVGGNETTKREFPWMALIEYTKPGNVKGHHCGGSLINHRYVLTAA 182

  Fly    83 HCTKGASSVTIYYGSTVR------------TSAKLKKKVSSSKFVQ--------HAGY--NAATL 125
            ||.....|.....|  ||            |..|..::..:..:|.        |..|  |:...
  Fly   183 HCVSAIPSDWELTG--VRLGEWDASTNPDCTVGKNGRRDCNEPYVDYPVEERIPHPQYPGNSRDQ 245

  Fly   126 RNDISLIK-TPSVTFTVSINKIALPAIASSYST-YAGQTAVASGWGRTSDSSIAVATNLQY-AQF 187
            .|||:|:: ...|.::..|..:.||.:||.::. :.|:..|.:|||||..:   ..:|::. |:.
  Fly   246 LNDIALLRLRDEVQYSDFILPVCLPTLASQHNNIFLGRKVVVAGWGRTETN---FTSNIKLKAEL 307

  Fly   188 QVITNAVCQKTFGSS--VVTSGVICVESINKKSTCQGDSGGPLAL--------NNRLIGVTSFVS 242
            ..:..:.|.:.:.:.  .||:..:|...:....:|:|||||||.|        |..:.||.|:..
  Fly   308 DTVPTSECNQRYATQRRTVTTKQMCAGGVEGVDSCRGDSGGPLLLEDYSNGNSNYYIAGVVSYGP 372

  Fly   243 SKGCEKNAPAGFTRVTSYLDWIKN 266
            :....|..|..:|||.:||:||:|
  Fly   373 TPCGLKGWPGVYTRVEAYLNWIEN 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 70/261 (27%)
Tryp_SPc 40..267 CDD:238113 72/264 (27%)
MP1NP_001303421.1 CLIP 29..91 CDD:288855
Tryp_SPc 137..394 CDD:214473 70/261 (27%)
Tryp_SPc 138..397 CDD:238113 72/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.