DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG18223

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:225 Identity:57/225 - (25%)
Similarity:96/225 - (42%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIANTWVLTAAHCTKGASSV-------TIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAAT 124
            :|||.||:.|::||:|||......:       .:..|:|.|  .|.:|.:|              
  Fly    78 FCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNR--LKSRKGLS-------------- 126

  Fly   125 LRNDISLIKTPSVTFTV-SINKIALPAIAS---------------SYSTYAGQTAVASGWGRTSD 173
            |..::..|..|. .||| :.|.|||..:|.               :.....|......||||...
  Fly   127 LNMEVKKIFVPD-KFTVFNTNNIALMMLAKKLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFK 190

  Fly   174 SSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINK---KSTCQGDSGGPLALNNRLI 235
            .. .:|:::.:...:::...:|:|..  .:....::|..::|.   ::.|.||:|.||..|..:.
  Fly   191 GG-PLASDILHIDVELLPRDICEKKV--HIFKEEMMCAGNLNNTMDENPCAGDTGSPLIFNETVF 252

  Fly   236 GVTSFVSSKGC-EKNAPAGFTRVTSYLDWI 264
            ||.|:  ..|| .|..|:.:|.|..::|||
  Fly   253 GVVSY--RVGCGSKTLPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 55/223 (25%)
Tryp_SPc 40..267 CDD:238113 57/225 (25%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 57/225 (25%)
Tryp_SPc 60..280 CDD:214473 55/223 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436855
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.