DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and ctrb1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002944677.2 Gene:ctrb1 / 394984 XenbaseID:XB-GENE-977509 Length:263 Species:Xenopus tropicalis


Alignment Length:242 Identity:85/242 - (35%)
Similarity:126/242 - (52%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSIDG--RITNGNKAAANQFPYQVGLSFKSSAGSW-WCGGSIIANTWVLTAAHCTKGASS-VTIY 94
            |.:.|  ||.||.:|....:|:||.|   ..:.|| :||||:|.|.||:|||||  |.|: ..:.
 Frog    26 PVVTGYARIVNGEEAVPGSWPWQVSL---QDSTSWHFCGGSLINNEWVVTAAHC--GVSTRDKVV 85

  Fly    95 YGSTVRTSAKLK-KKVSSSKFVQHAGYNAATLRNDISLIK--TPSVTFTVSINKIALPAIASSYS 156
            .|...|.|...| :.::.:|...|..:|:.|:.|||||||  ||:| ...::..:.|..|...|.
 Frog    86 LGEHDRGSNVEKIQSLAVAKVFTHPQWNSNTINNDISLIKLATPAV-IGATVAPVCLANIGEDYE 149

  Fly   157 TYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQ 221
              .|:..|.||||:|..::......||.....::||..|:..:|:: :|..:||..:.. .|:|.
 Frog   150 --GGRICVTSGWGKTRYNAFTTPNQLQQTALPLLTNDQCKSYWGNN-ITGTMICAGAAG-SSSCM 210

  Fly   222 GDSGGPLALNNR----LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            |||||||.....    |:|:.|:.||. |..:.||.:.||.....|:
 Frog   211 GDSGGPLVCQANDAWTLVGIVSWGSSM-CSTSTPAVYARVAVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 82/233 (35%)
Tryp_SPc 40..267 CDD:238113 82/234 (35%)
ctrb1XP_002944677.2 Tryp_SPc 33..256 CDD:214473 82/233 (35%)
Tryp_SPc 34..259 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.