DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG18180

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:278 Identity:107/278 - (38%)
Similarity:155/278 - (55%) Gaps:20/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAV-LVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFK---S 61
            ||:|.: |..|:|.|:|    ..|.:: |.:......:|||.||..|...:.||.|||..:   |
  Fly     1 MKLFLLTLSAALALVAA----SPTGLN-RTTLLSQGAEGRIVNGYPAPEGKAPYIVGLFIRTDGS 60

  Fly    62 SAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLR 126
            ::|:.. .|:||||.|:||||||..| ..|.|:|||....:...::.|....|:.|..:.:...|
  Fly    61 NSGAVG-AGTIIANDWILTAAHCLTG-DYVEIHYGSNWGWNGAYRQTVRRDNFISHPDWPSQGGR 123

  Fly   127 NDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVIT 191
             ||.||:||.|.|...||||.||::......|.....||.|||...:.::  |..||....|:|:
  Fly   124 -DIGLIRTPHVDFNGLINKIPLPSMNEQNDRYQDTWCVACGWGGMDNGNL--ADWLQCVDVQIIS 185

  Fly   192 NAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL--NNRLIGVTSFVSSKGCEKNAPAGF 254
            |:.|::.:||  |.|..:|....:.||.|.|||||||..  |.||:||.:| :|..|. :.|:|:
  Fly   186 NSECEQAYGS--VASTDMCTRHADGKSVCGGDSGGPLVTHDNARLVGVITF-ASVSCH-DGPSGY 246

  Fly   255 TRVTSYLDWIKNQSGVFY 272
            |||:.||:||::|:|:.|
  Fly   247 TRVSDYLEWIRDQTGISY 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 91/229 (40%)
Tryp_SPc 40..267 CDD:238113 92/231 (40%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 91/229 (40%)
Tryp_SPc 36..259 CDD:238113 92/231 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.