DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG18179

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:287 Identity:108/287 - (37%)
Similarity:159/287 - (55%) Gaps:34/287 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAV-LVLAIATVSADILRQDTPVHPRDSSAVPSI------DGRITNGNKAAANQFPYQVGL- 57
            ||:|.: |.:|:|.|:|      :|...| :|.:|.:      :|||.||..|...:.||.||| 
  Fly     1 MKLFLLTLSVALAVVAA------SPGFNR-TSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLL 58

  Fly    58 -----SFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQH 117
                 |..::.|:    |:|||:.|:||||||.. ...|.|:|||....:...::.|....|:.|
  Fly    59 IRTDGSNSAAVGA----GTIIASDWILTAAHCLT-TDYVEIHYGSNWGWNGAFRQSVRRDNFISH 118

  Fly   118 AGYNAATLRNDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNL 182
            ..:.|...| ||.||:||||.||..|||:|||:.:.....:.....||.|||...:.::  |..|
  Fly   119 PNWPAEGGR-DIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNL--ADWL 180

  Fly   183 QYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL--NNRLIGVTSFVSSKG 245
            |....|:|:|:.|::::|:  |.|..:|....:.||:|.|||||||..  |.||:||.:| .|..
  Fly   181 QCMDVQIISNSECEQSYGT--VASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITF-GSVD 242

  Fly   246 CEKNAPAGFTRVTSYLDWIKNQSGVFY 272
            |. :.|:|:||||.||.||::.:|:.|
  Fly   243 CH-SGPSGYTRVTDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 91/232 (39%)
Tryp_SPc 40..267 CDD:238113 92/234 (39%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 91/232 (39%)
Tryp_SPc 40..263 CDD:238113 92/234 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470846
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.