DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG8329

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:277 Identity:110/277 - (39%)
Similarity:155/277 - (55%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFAVLVLAIATVSADILRQDTPVH---PRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSA 63
            |...:|:|.:|||.|...|..|..|   |:|.         |.||..|...:.||.|||...:.|
  Fly     3 KKLVLLLLFVATVCAHRNRNRTAHHGGGPKDI---------IVNGYPAYEGKAPYAVGLRMNNGA 58

  Fly    64 GSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGY-NAATLRN 127
            ..   |||:|.|.||||||||.. ..||||:|||....:.:|:..|:.:.|.:|.|| |:|  .:
  Fly    59 VG---GGSVIGNNWVLTAAHCLT-TDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSA--GH 117

  Fly   128 DISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITN 192
            ||.||:||.|:||..|||::||..:.....:.....||.|||..::..:  |..||....|||:|
  Fly   118 DIGLIRTPYVSFTNLINKVSLPKFSQKGERFENWWCVACGWGGMANGGL--ADWLQCMDVQVISN 180

  Fly   193 AVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNR--LIGVTSFVSSKGCEKNAPAGFT 255
            ..|.:::||  |.|..:|..:.:.||.|.|||||.|..::.  .:||.:| :|.|| |:.|:|:|
  Fly   181 GECARSYGS--VASTDMCTRATDGKSVCGGDSGGALVTHDNPIQVGVITF-ASIGC-KSGPSGYT 241

  Fly   256 RVTSYLDWIKNQSGVFY 272
            ||:.:||||:.:||:.|
  Fly   242 RVSDHLDWIREKSGIAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 93/227 (41%)
Tryp_SPc 40..267 CDD:238113 95/229 (41%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 95/229 (41%)
Tryp_SPc 35..250 CDD:214473 93/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470840
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.