DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG10469

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:253 Identity:98/253 - (38%)
Similarity:139/253 - (54%) Gaps:33/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGL--SFKSSAGS-WWCGGSIIANTWVLTAAHCTKGASS----VTIYYG 96
            ||.||..|.|.|.||||||  .|:.|... ..|||:|::|.|::|||||.:...|    |.|:.|
  Fly    23 RIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG 87

  Fly    97 STVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTP-SVTFTVSINKIALPA-IASSYSTYA 159
            . |::....:..|:.|..:.|..::..|:.|||:|||.| .:||    ||...|| :.|:..||.
  Fly    88 K-VKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTF----NKYIQPAKLPSAKKTYT 147

  Fly   160 GQTAVASGWGRTS---DSSIAVATNLQYAQFQVITNAVCQKTF-----GSS--VVTSGVICVESI 214
            |:.|:.||||.|:   .|.:     |||.:..:|:|..|::.:     |.|  ||.:|.||::| 
  Fly   148 GRKAIISGWGLTTKQLPSQV-----LQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDS- 206

  Fly   215 NKKSTCQGDSGGPLALNN---RLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQSG 269
            .|...|:||||||:.|::   .|:|:.|......|:...|...|||:|||.|||..||
  Fly   207 KKGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVSTRVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 93/246 (38%)
Tryp_SPc 40..267 CDD:238113 95/248 (38%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 93/246 (38%)
Tryp_SPc 24..260 CDD:238113 93/246 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470987
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.910

Return to query results.
Submit another query.