DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG6592

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648016.1 Gene:CG6592 / 38687 FlyBaseID:FBgn0035669 Length:438 Species:Drosophila melanogaster


Alignment Length:248 Identity:95/248 - (38%)
Similarity:142/248 - (57%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSA 103
            ||..|:....:.||||||:..:...|.:|||||:|::..|:|||||...|....::.|:....:|
  Fly   122 RIFGGDVGNPHCFPYQVGMLLQRPKGLYWCGGSLISDKHVITAAHCVDMAKRALVFLGANEIKNA 186

  Fly   104 KLKKK----VSSSKFVQHAGYNAATLRNDISLIKTP-SVTFTVSINKIALPAIASSYSTYAGQTA 163
            |.|.:    |.|..|..:..:|...|::||::::.| :|:|...|:.|.||.....|.::..:.|
  Fly   187 KEKGQVRLMVPSENFQIYPTWNPKRLKDDIAIVRLPHAVSFNERIHPIQLPKRHYEYRSFKNKLA 251

  Fly   164 VASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTF-----GSSVVTSGVICVESINKKSTCQGD 223
            :||||||.:....|::..|:|.|.|:|....|:..|     |:::.|||      .|.:|||.||
  Fly   252 IASGWGRYATGVHAISNVLRYVQLQIIDGRTCKSNFPLSYRGTNICTSG------RNARSTCNGD 310

  Fly   224 SGGPLALNNR------LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQSGV 270
            |||||.|..|      |:|:|||.|..||::..||.||:|.||||||.:::||
  Fly   311 SGGPLVLQRRHSKKRVLVGITSFGSIYGCDRGYPAAFTKVASYLDWISDETGV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 91/240 (38%)
Tryp_SPc 40..267 CDD:238113 92/242 (38%)
CG6592NP_648016.1 Tryp_SPc 122..357 CDD:214473 91/240 (38%)
Tryp_SPc 123..359 CDD:238113 92/241 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470988
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1010.000

Return to query results.
Submit another query.