DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Jon65Ai

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:278 Identity:125/278 - (44%)
Similarity:161/278 - (57%) Gaps:22/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVL-AIATVSA---DILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKS 61
            |||.|||:| .||:.:|   .:..:|.||      ...||:||||.|..|...:.||.|||.|..
  Fly     1 MKVLAVLLLGVIASATAFEKPVFWKDVPV------GKASIEGRITMGYPAYEGKVPYIVGLGFSK 59

  Fly    62 SAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLR 126
            :.|..|||||||.||||:||.|||.|..|||||||:..|..|:....|..|.|::|..       
  Fly    60 NGGGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGS------- 117

  Fly   127 NDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVIT 191
            .|||||:||.|.|...:||:.||.....|:.|.|..|:.||||:|||.. .|:..|.....|:..
  Fly   118 GDISLIRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEG-GVSEYLNCVDVQIGE 181

  Fly   192 NAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALN--NRLIGVTSFVSSKGCEKNAPAGF 254
            |:||:..:||  .:..:||:.:...|.||.|||||||.::  ||.:|:.||.||.||..|.|.|.
  Fly   182 NSVCENYYGS--FSGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGM 244

  Fly   255 TRVTSYLDWIKNQSGVFY 272
            .|||||||||::.:|:.|
  Fly   245 VRVTSYLDWIRDNTGISY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 105/226 (46%)
Tryp_SPc 40..267 CDD:238113 106/228 (46%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 105/226 (46%)
Tryp_SPc 41..257 CDD:238113 104/225 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470831
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.