DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:268 Identity:150/268 - (55%)
Similarity:191/268 - (71%) Gaps:3/268 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSA-GSWWCG 69
            :::||:|..::.....:.....|:...|..|.||||.|:.||..|||||||||.|.|| .|.|||
  Fly     4 LIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCG 68

  Fly    70 GSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKT 134
            ||:|.:||||||||||.|..|||:|.|:||||||::...||||..:.|:|:|:|.|||||||||.
  Fly    69 GSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKI 133

  Fly   135 PSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTF 199
            |:.:.:..|:.:.||:|::||||:.|..|||||||||||:|..|||||||....||||..|.:|:
  Fly   134 PATSSSSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTY 198

  Fly   200 GSSVVTSGVICVESINKKSTCQGDSGGPLAL--NNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLD 262
            |:||||...:||.:.:.||||.|||||||.|  ::..||:|||.:|.||||..||.|||||||||
  Fly   199 GTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSFGASAGCEKGYPAAFTRVTSYLD 263

  Fly   263 WIKNQSGV 270
            |||..:|:
  Fly   264 WIKTNTGI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 139/227 (61%)
Tryp_SPc 40..267 CDD:238113 141/229 (62%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 139/227 (61%)
Tryp_SPc 38..268 CDD:238113 141/229 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470885
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1111.010

Return to query results.
Submit another query.