DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and yip7

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:270 Identity:180/270 - (66%)
Similarity:214/270 - (79%) Gaps:0/270 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65
            ||||.|||||:|:.||.:|....||||||..:.|||.||||||..|.|.||||||||||.|||||
  Fly     1 MKVFVVLVLALASASAGLLPNIAPVHPRDRVSTPSITGRITNGKDAVAGQFPYQVGLSFSSSAGS 65

  Fly    66 WWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDIS 130
            ||||||||.|.|||||||||.||:|||||||:|||||.:..:.||||||.||..|.|.|:|||||
  Fly    66 WWCGGSIIGNEWVLTAAHCTDGAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLALTIRNDIS 130

  Fly   131 LIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVC 195
            ||:|.||:|:.::|||:|||:::|||||.|:||||||||.|||.:.||:.:|||....:|:|:.|
  Fly   131 LIQTSSVSFSATVNKISLPAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSKC 195

  Fly   196 QKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSY 260
            |:||||.:|||.|:||::.||.|||||||||||||:..|||.|||.|:.|||..|||.|||:|.|
  Fly   196 QETFGSLIVTSRVLCVDTTNKASTCQGDSGGPLALDGVLIGATSFGSADGCESGAPAAFTRITYY 260

  Fly   261 LDWIKNQSGV 270
            .||||..||:
  Fly   261 RDWIKETSGI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 152/224 (68%)
Tryp_SPc 40..267 CDD:238113 154/226 (68%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 152/224 (68%)
Tryp_SPc 40..267 CDD:238113 154/226 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470685
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1211.910

Return to query results.
Submit another query.