DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG30283

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:287 Identity:83/287 - (28%)
Similarity:130/287 - (45%) Gaps:48/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFAVLVLAIATVSADILRQDTP---VHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSA 63
            |:|.|:|| :|..|..:|..::.   .||  ...||....:|..|:.|.....|:   ::.....
  Fly     5 KIFVVVVL-LAASSVVVLGSESGSFLEHP--CGTVPISQFKILGGHNAPVASAPW---MAMVMGE 63

  Fly    64 GSWWCGGSIIANTWVLTAAHC-TKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRN 127
            |.:.|||::|.|.:|||:||| ..|...|.:   ..:...|:.:|....:.|| |..|...  ::
  Fly    64 GGFHCGGTLITNRFVLTSAHCIANGELKVRL---GVLEREAEAQKFAVDAMFV-HTDYYFD--QH 122

  Fly   128 DISLIK-TPSVTFTVSINKIAL---PAIAS------SYSTYAGQTAVASGWGRTSDSSIAVATNL 182
            |::|:: ...|.::.:|:.|.|   |.:.:      .:.||        |||:|...|  .:..|
  Fly   123 DLALLRLAKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTY--------GWGKTESRS--SSRML 177

  Fly   183 QYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL-----NNRLI---GVTS 239
            |......:..:.|.|.:....:....||.||.| .:||.|||||||..     :.:::   ||||
  Fly   178 QKTSLFNLHRSECAKQYPHQQINRNHICAESAN-ANTCNGDSGGPLTAIVTYDHVQMVFQFGVTS 241

  Fly   240 FVSSKGCEKNAPAGFTRVTSYLDWIKN 266
            | ....|.|  ...||.|.::||||.|
  Fly   242 F-GHADCSK--ATVFTNVMTHLDWIVN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/243 (28%)
Tryp_SPc 40..267 CDD:238113 71/246 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 68/243 (28%)
Tryp_SPc 43..266 CDD:238113 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.