DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG10764

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:260 Identity:79/260 - (30%)
Similarity:120/260 - (46%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHC-TKGASS 90
            |...|..|.|.|    |:.||.   |..:.::...::..:.|||:||...:||:|||| .:|   
  Fly    29 PCGISTRPKISG----GDDAAE---PNSIWMAAIFNSSDFQCGGTIIHMRFVLSAAHCLVRG--- 83

  Fly    91 VTIYYGSTVRTSAKLKKKVSS-----SKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL- 148
                |...||..|:...:.::     :.||.| .:.|:..||||.|:: :.|:.:||.:..|.: 
  Fly    84 ----YDLYVRLGARNINEPAAVHTVINVFVHH-DFIASEYRNDIGLLQLSESIVYTVRVQPICIF 143

  Fly   149 --PAIASSYSTYAGQTAVASGWG-RTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVIC 210
              ||:..|....  :|..|.||| |....||.    ||......:....|::....: :.|..||
  Fly   144 LDPALKGSVEKL--KTFRALGWGNRNGKLSIM----LQTIYLLHLKRNECKRKLNFN-LNSRQIC 201

  Fly   211 VESINKKSTCQGDSGGPLALN-----NR----LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKN 266
            ..:.| ..||:|||||||:.|     |:    .:|:.||...   |......:|.||||:|||.:
  Fly   202 AGTKN-GDTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGDP---ECRGVGVYTDVTSYVDWISS 262

  Fly   267  266
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 72/244 (30%)
Tryp_SPc 40..267 CDD:238113 74/247 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 74/248 (30%)
Tryp_SPc 38..263 CDD:238113 76/251 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436212
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.