DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and scaf

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:225 Identity:56/225 - (24%)
Similarity:98/225 - (43%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKG--ASSVTIYYG--STVRTSAKLKKKVS 110
            :.|:| .:..:.|:.:..|||:||.:.:||::|.|..|  .:.:.:..|  ....|:..|..:::
  Fly   433 EIPWQ-AMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGSTNEPLPFQLT 496

  Fly   111 SSKFVQ-HAGYNAATLRNDISLIKTP-SVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSD 173
            ..|.|. |..|:.:|..:|:::|:.. .:.|...|..|.:    |.......:....||||:.  
  Fly   497 GVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICI----SDEDPKDSEQCFTSGWGKQ-- 555

  Fly   174 SSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNN----RL 234
               |::.:.:.|...| |:.:.|.....|..:|.| |  |..|..:||.|.|..||..:    ||
  Fly   556 ---ALSIHEEGALMHV-TDTLPQARSECSADSSSV-C--SATKFDSCQFDVGSALACGSGSSVRL 613

  Fly   235 IGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            .|:  |.....|.:.....|.:..  :.||
  Fly   614 KGI--FAGENSCGEGQTVRFAKPD--IKWI 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 54/223 (24%)
Tryp_SPc 40..267 CDD:238113 56/225 (25%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 50/196 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435400
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.