DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG4650

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:247 Identity:64/247 - (25%)
Similarity:111/247 - (44%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IDGR---ITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGS 97
            :|||   :|||..|.....|:...|  .:|...:.|||::|....||||||||:.:..:....|.
  Fly    24 LDGRCGLLTNGKIANNISSPWMAYL--HTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGE 86

  Fly    98 TVRT----SAKLKKKVSSSKFVQHAGYNAATLRNDISLI-KTPSVTFTVSINKIALPAIASSYST 157
            .:.|    ...|.:...|..|: |:.||..|..|||::: ....:.|:.:|..|.: ...:.:..
  Fly    87 FIGTDDANDTMLSEYQVSQTFI-HSLYNTTTSANDIAILGLATDIVFSKTIRPICI-VWWTIWRK 149

  Fly   158 YAGQTAVASG--WGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTC 220
            |.....|.||  ||..:|.:.:.|..:...:.|...  :|....|:::::|.....:|.:|  .|
  Fly   150 YIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPAN--MCSTLNGTAILSSQFCAGDSDSK--LC 210

  Fly   221 QGDSGGPLAL--------NNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            ..|...||..        ...|||:.:  :::.|::  .:.:|.|.|:.|:|
  Fly   211 NVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKCKR--ASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 61/242 (25%)
Tryp_SPc 40..267 CDD:238113 61/240 (25%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 59/236 (25%)
Tryp_SPc 33..258 CDD:304450 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.