DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG9377

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:144 Identity:32/144 - (22%)
Similarity:61/144 - (42%) Gaps:18/144 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGA--SSVTIYYG---STVRTSAK 104
            :|...:||:.|.:   ..:.::.|.|::|....|:|.|||.:.:  ..|.:..|   :.|....:
  Fly   106 EAKFGEFPWLVAV---YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQ 167

  Fly   105 LKKKVSSSKFVQHAGYNAATLRNDISLI---KTPSVTFTVSINKIAL--PAIASSYSTYAGQTAV 164
            ..::.|..:.:.|..|....|.::|:::   |........::..|.|  |.|..:||     ...
  Fly   168 PHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYS-----QCY 227

  Fly   165 ASGWGRTSDSSIAV 178
            .|||.|:.....|:
  Fly   228 VSGWQRSDFGRAAI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 32/144 (22%)
Tryp_SPc 40..267 CDD:238113 32/144 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 32/144 (22%)
Tryp_SPc 105..339 CDD:214473 32/144 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435365
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.