DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Hayan

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001097020.1 Gene:Hayan / 32831 FlyBaseID:FBgn0030925 Length:637 Species:Drosophila melanogaster


Alignment Length:262 Identity:67/262 - (25%)
Similarity:116/262 - (44%) Gaps:54/262 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGNKAAANQFPYQVGLSFKS-SAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSA 103
            |.:|.:.....:|:...:::.| .:.::.||||:||:.:|||||||.....|..    |.||..|
  Fly   385 ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDDSTP----SFVRLGA 445

  Fly   104 -KLKKKVSSSKFVQ------HAGYNAATLRNDISLIK-----------TPSVTFTVSINKIALPA 150
             .::......:.:.      |..|:.::...||::::           .|:..:|   ::...||
  Fly   446 LNIENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYT---DRSDPPA 507

  Fly   151 IASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGS----------SVVT 205
               :|..:      .:|||..:.::.||:..|..|...::....|..:|..          .|:.
  Fly   508 ---NYKYF------VAGWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRGVIA 563

  Fly   206 SGVICVESINKKSTCQGDSGGPLAL-------NNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDW 263
            |.:...:...:|..|||||||||.|       ...::||.|  |..||....|..:|||:|:||:
  Fly   564 SQLCAADKNQRKDACQGDSGGPLILEIDDVDGTYSIVGVIS--SGFGCATKTPGLYTRVSSFLDY 626

  Fly   264 IK 265
            |:
  Fly   627 IE 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 66/259 (25%)
Tryp_SPc 40..267 CDD:238113 67/262 (26%)
HayanNP_001097020.1 CLIP 32..80 CDD:197829
Tryp_SPc 384..627 CDD:214473 66/259 (25%)
Tryp_SPc 385..630 CDD:238113 67/262 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437030
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.