DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and sphe

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:241 Identity:78/241 - (32%)
Similarity:110/241 - (45%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTK------GASSVTIYYG 96
            |||..|..|.|....:...|...:   :..|||||::.|.:||.|||..      .||.:....|
  Fly    24 GRIMGGEDADATATTFTASLRVDN---AHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVG 85

  Fly    97 STVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPS-VTFTVSINKIALPAIASSYSTYA- 159
            ||.:.:.  .|.|:......|..|  ..|.|::::|...| :|:|..|.  |:|.:||..:..| 
  Fly    86 STNQYAG--GKIVNVESVAVHPDY--YNLNNNLAVITLSSELTYTDRIT--AIPLVASGEALPAE 144

  Fly   160 GQTAVASGWGRTSDSSIAVATN---LQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQ 221
            |...:.:|||||||     .||   ::....:|...|.|...:......|  .|:....|:.||.
  Fly   145 GSEVIVAGWGRTSD-----GTNSYKIRQISLKVAPEATCLDAYSDHDEQS--FCLAHELKEGTCH 202

  Fly   222 GDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQ 267
            ||.||.....|.|||:|:||.. .|....|..|.|::||.|||:.|
  Fly   203 GDGGGGAIYGNTLIGLTNFVVG-ACGSRYPDVFVRLSSYADWIQEQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 74/235 (31%)
Tryp_SPc 40..267 CDD:238113 75/237 (32%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 71/221 (32%)
Tryp_SPc 42..244 CDD:214473 69/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.