DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG11664

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:262 Identity:68/262 - (25%)
Similarity:112/262 - (42%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGG 70
            :::||||....|.|.:..||..::...|..|.|          .||               ...|
  Fly    10 LILLAIAVRWGDALHRGIPVQQQNYGYVMQIYG----------PQF---------------LAAG 49

  Fly    71 SIIANTWVLTAAHCTKGAS-----SVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDIS 130
            |:.:..:|||.|||.|..:     ||...|    |..|...:....:..::|..::..||||||:
  Fly    50 SLFSARYVLTVAHCFKKNTKPEELSVRAGY----RWIAWEFRGKQVAGLLRHPKFSPLTLRNDIA 110

  Fly   131 LIKT-PSVTFTVSINKIAL---PAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVIT 191
            :::. .:::.:..||.|.|   |  .:..:.:|....:| ||     :.:.:|..|:....||..
  Fly   111 VLRVKAAISHSHMINYIGLCSRP--LTPLNMFAPPQELA-GW-----NLMHIAQPLKSMSVQVEP 167

  Fly   192 NAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFVSSKGC-EKNAPAGFT 255
            ...|::.|..  ::.||||..:...:..|.||||.||.....:.|:.  ::.:.| :|..||.||
  Fly   168 EKNCRQWFPQ--ISGGVICASATMGEGLCYGDSGDPLISGGEVCGLA--IAFRKCGDKRYPALFT 228

  Fly   256 RV 257
            .|
  Fly   229 DV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 57/229 (25%)
Tryp_SPc 40..267 CDD:238113 57/228 (25%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 59/234 (25%)
Tryp_SPc 38..237 CDD:214473 59/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.