DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Cela3b

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:249 Identity:84/249 - (33%)
Similarity:124/249 - (49%) Gaps:26/249 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PSIDGRITNGNKAAANQFPYQVGLSFKSSAGSW--WCGGSIIANTWVLTAAHCTKGASSVTIYYG 96
            ||  .|:.||..|....:|:||.|.::.. ||:  .|||::||..||:||.||...:.:..:..|
  Rat    24 PS--SRVVNGEDAVPYSWPWQVSLQYEKD-GSFHHTCGGTLIAPDWVMTAGHCISTSRTYQVVLG 85

  Fly    97 STVRTSAKLKKKV----SSSKFVQHAGYNA--ATLRNDISLIK-TPSVTFTVSINKIALPAIASS 154
            ...|...:..::|    :...|| |..:|:  .:..|||:|:| :.|.....::....||.....
  Rat    86 EFERGVEEGPEQVIPVNAGDLFV-HPKWNSNCVSCGNDIALVKLSRSAQLGDTVQLACLPPAGEI 149

  Fly   155 YSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQK--TFGSSVVTSGVICVESINKK 217
            ...  |.....|||||.|.:. .:...||.|...|:..|.|.|  .:|.||..: ::|... :.:
  Rat   150 LPN--GAPCYISGWGRLSTNG-PLPDKLQQALLPVVDYAHCSKWDWWGFSVKKT-MVCAGG-DIQ 209

  Fly   218 STCQGDSGGPL---ALNN--RLIGVTSFVSSKGCEK-NAPAGFTRVTSYLDWIK 265
            |.|.|||||||   |.|.  ::.||||||||.||.. ..|..||||:::.:||:
  Rat   210 SGCNGDSGGPLNCPAENGTWQVHGVTSFVSSLGCNTLKKPTVFTRVSAFNEWIE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 80/241 (33%)
Tryp_SPc 40..267 CDD:238113 81/243 (33%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 80/241 (33%)
Tryp_SPc 28..265 CDD:238113 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.