DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Mcpt2

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:243 Identity:70/243 - (28%)
Similarity:108/243 - (44%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VPSIDG--RITNGNKAAANQFPYQVGLSFKSSAG-SWWCGGSIIANTWVLTAAHCTKGASSVTIY 94
            :||..|  .|..|.::..:..||...|...:..| ...|||.:|:..:||||||| ||.....|.
  Rat    12 LPSGAGAEEIIGGVESIPHSRPYMAHLDIVTEKGLRVICGGFLISRQFVLTAAHC-KGREITVIL 75

  Fly    95 YGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTY 158
            ....||.....::|:...|.:.|..||:....:||.|:| ...|..|.::|.:.||  :.|...:
  Rat    76 GAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLLKLEKKVELTPAVNVVPLP--SPSDFIH 138

  Fly   159 AGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVC------QKTFGSSVVTSGVICVES-INK 216
            .|....|:|||:|.... ..:..|:..:.:::....|      :..|        .:||.| ...
  Rat   139 PGAMCWAAGWGKTGVRD-PTSYTLREVELRIMDEKACVDYRYYEYKF--------QVCVGSPTTL 194

  Fly   217 KSTCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            ::...|||||||.......|:.|:...   :...||.||||::|:.||
  Rat   195 RAAFMGDSGGPLLCAGVAHGIVSYGHP---DAKPPAIFTRVSTYVPWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 65/233 (28%)
Tryp_SPc 40..267 CDD:238113 67/234 (29%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 65/233 (28%)
Tryp_SPc 21..242 CDD:238113 67/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.