DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Prss34

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:266 Identity:77/266 - (28%)
Similarity:124/266 - (46%) Gaps:36/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWW---CGGSIIANTWVLTAAHCT 85
            |:.|.....:..|.|    |...:|::||:||.|.|.:...|.|   ||||:|...||||||||.
  Rat    21 PLTPDSGQELVGIVG----GCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLTAAHCV 81

  Fly    86 K----GASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYN---AATLRNDISLIKTPS-VTFTVS 142
            :    .||...:..|...........||  :|.::|..::   :|....||:|:|..| |..:..
  Rat    82 ELKEMEASCFRVQVGQLRLYENDQLMKV--AKIIRHPKFSEKLSAPGGADIALLKLDSTVVLSER 144

  Fly   143 INKIALPAIASSYSTYAGQTAVASGWG-RTSDSSIAVATNLQYAQFQVITNAVCQ---KTFGS-- 201
            ::.::|||.:...|  :.:|...:||| ......:....:|:.....::.|:.|:   :|:.|  
  Rat   145 VHPVSLPAASQRIS--SKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSDCEQKYRTYSSLD 207

  Fly   202 ---SVVTSGVICVESINKKSTCQGDSGGPLALNNRL----IGVTSFVSSKGCE-KNAPAGFTRVT 258
               .::...::|. .:..:.:||.||||||......    :||.|:  ..||. .:.|..:|||.
  Rat   208 RTTKIIKDDMLCA-GMEGRDSCQADSGGPLVCRWNCSWVQVGVVSW--GIGCGLPDFPGVYTRVM 269

  Fly   259 SYLDWI 264
            |||.||
  Rat   270 SYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/249 (29%)
Tryp_SPc 40..267 CDD:238113 73/250 (29%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 75/254 (30%)
Tryp_SPc 33..275 CDD:214473 73/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.