DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Prss30

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:284 Identity:77/284 - (27%)
Similarity:130/284 - (45%) Gaps:45/284 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWW 67
            :|.:|:..:.....|||....              |:|..|..|...::|:||  |.::......
  Rat     8 IFLLLLQILTGGRGDILHSGA--------------GKIVGGQDAPEGRWPWQV--SLRTEKEGHI 56

  Fly    68 CGGSIIANTWVLTAAHCTKGASSVTIYY----GSTVRTSAKLKKKVSSSKFVQHAGY---NAATL 125
            ||||:|...||||||||.....:.:.|:    |.|:..:......|:......:..|   :|:: 
  Rat    57 CGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASS- 120

  Fly   126 RNDISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVI 190
             .||:|::..:.......:.:.||...:..:  .|.....:|||.|.:..:  |:.||.....::
  Rat   121 -GDIALLRLDTPLQPSQFSPVCLPQAQAPLT--PGTVCWVTGWGATHEREL--ASVLQELAVPLL 180

  Fly   191 TNAVCQKTF--------GSSVVTSGVICVESI-NKKSTCQGDSGGPL--ALNNRLI--GVTSFVS 242
            .:..|::.:        |..|:.|.::|...: .:|.:|||||||||  |:|:..|  |:||:  
  Rat   181 DSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSW-- 243

  Fly   243 SKGCEK-NAPAGFTRVTSYLDWIK 265
            ..||.: |.|..:|||..|:|||:
  Rat   244 GIGCARPNKPGVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 69/245 (28%)
Tryp_SPc 40..267 CDD:238113 71/247 (29%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.