DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG18636

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:113/248 - (45%) Gaps:35/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSA 103
            ||.||:.|..|..|:.|.|  .|:...:.||||:|.:..|||||||......:....|...||.:
  Fly    44 RIINGHTAKYNSSPWMVFL--HSTTDMFVCGGSLITDKLVLTAAHCFIANQHLVARLGEYERTRS 106

  Fly   104 K--------LKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYA 159
            :        .:::.......:|..|:..|..|||:::: :.||.:..:|..|.: .....:..|.
  Fly   107 EECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPICV-VWDHRWRHYL 170

  Fly   160 GQ--TAVASGWGRT---SDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKST 219
            .:  ...|:|||:|   |||..     ||....:.....||.|..|.: :.....|..:.: .:.
  Fly   171 DKIDLLTATGWGKTQMESDSDA-----LQTLDIRRQPPDVCAKFIGQT-IAGNQFCAGNWD-SNL 228

  Fly   220 CQGDSGGPLAL-----NNR---LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWI 264
            |.|||||||..     |.:   .:|:.|: :::.|:|  .:.||.|.|:.::|
  Fly   229 CNGDSGGPLGAVITHKNTQRFVQVGIASY-TNRNCQK--ASVFTDVLSHAEFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/246 (28%)
Tryp_SPc 40..267 CDD:238113 68/247 (28%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 68/246 (28%)
Tryp_SPc 45..278 CDD:238113 67/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436198
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.