DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG33461

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:119/290 - (41%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCG 69
            |:.||.:...|:..|.::..|       ||.:..:|.||..|...::|:   ::|..:...:.|.
  Fly    14 ALFVLGVHGSSSVFLEENCGV-------VPRLSYKIINGTPARLGRYPW---MAFLHTPTYFLCA 68

  Fly    70 GSIIANTWVLTAAHCTKGASSVTIYYGSTVRTS---------AKLKKKVSSSKFVQHAGYNAATL 125
            ||:|...:|||:|||.:....:....|...|.:         .:..::.:.....:|..|:....
  Fly    69 GSLINQWFVLTSAHCIEDDVELIARLGENNRDNDIDCENNRCLEATQEYNVDMLFKHRLYDPKDF 133

  Fly   126 RNDISLIKTP-SVTFTVSINKIA------LPAIASSYSTYAGQTAVASGWGRTS------DSSIA 177
            .|||.:::.. .|.:|..|..|.      :..:....:.:.     |:|||.||      .|.:.
  Fly   134 SNDIGMLRLERRVEYTYHIQPICIFHHRRMQLVVDQITWFK-----ATGWGLTSTDLNTKSSRVL 193

  Fly   178 VATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSFV- 241
            :..|| |.:    ....|.:.|..:.: ||.||..: :..:.|:||||||......:.|:..|| 
  Fly   194 MELNL-YRR----PRNDCARIFKQNFL-SGQICAGN-DDGNLCRGDSGGPQGRYVLIFGMKRFVQ 251

  Fly   242 ------SSKGCEKNAPAGFTRVTSYLDWIK 265
                  :.:.|.|  .:..|.|..|..|||
  Fly   252 MGIASFTYENCSK--VSILTDVVRYGRWIK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 58/253 (23%)
Tryp_SPc 40..267 CDD:238113 61/255 (24%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 58/253 (23%)
Tryp_SPc 42..281 CDD:238113 61/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.