DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:271 Identity:74/271 - (27%)
Similarity:115/271 - (42%) Gaps:65/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 HPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASS 90
            ||:.|::    ..||..|:.|.|..:|:|..|....   ...||||:::..||||||||..|:  
Mouse    77 HPQVSNS----GSRIVGGHAAPAGTWPWQASLRLHK---VHVCGGSLLSPEWVLTAAHCFSGS-- 132

  Fly    91 VTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATL----------------------RNDISLIK 133
                              |:||.:..|.|....||                      ..||:|::
Mouse   133 ------------------VNSSDYQVHLGELTVTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQ 179

  Fly   134 TPS-VTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSS-IAVATNLQYAQFQVITNAVCQ 196
            ..| |..:..:..:.||..::.:  |.|.....:|||.|.:.. :....|||.|:..|:....|.
Mouse   180 LSSPVALSSQVQPVCLPEASADF--YPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCS 242

  Fly   197 KTFGS---SVVTSGVICVESINKKSTCQGDSGGPL----ALNNRLIGVTSFVSSKGCEK-NAPAG 253
            :.:.|   |::...::|..  .....||.||||||    |...:..||.|:  .:||.: :.|..
Mouse   243 QAYNSPNGSLIQPDMLCAR--GPGDACQDDSGGPLVCQVAGTWQQAGVVSW--GEGCGRPDRPGV 303

  Fly   254 FTRVTSYLDWI 264
            :.|||:|::||
Mouse   304 YARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 69/256 (27%)
Tryp_SPc 40..267 CDD:238113 70/257 (27%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 70/257 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.