DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and PRSS33

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:308 Identity:80/308 - (25%)
Similarity:116/308 - (37%) Gaps:82/308 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAV--PSIDGRITNGNKAAANQFPYQVGLSFKSSA 63
            ::|..:|||..|....           |.|:|.  |.:..||..|......::|:|..:..:   
Human     7 LQVLLLLVLGAAGTQG-----------RKSAACGQPRMSSRIVGGRDGRDGEWPWQASIQHR--- 57

  Fly    64 GSWWCGGSIIANTWVLTAAHCTKGASSVTIY--------YGST-VRTSAKLKKKVSSSKFVQHAG 119
            |:..||||:||..||||||||....:....|        .||| .||.:     |...:.:....
Human    58 GAHVCGGSLIAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLS-----VPVRRVLLPPD 117

  Fly   120 YNAATLRNDISL--IKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWG------------- 169
            |:....|.|::|  ::.| |..:..:..:.||...:  ....|.....:|||             
Human   118 YSEDGARGDLALLQLRRP-VPLSARVQPVCLPVPGA--RPPPGTPCRVTGWGSLRPGVPLPEWRP 179

  Fly   170 -----------RTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICV-ESINKKSTCQG 222
                       ||.|....|..::..|:               .:|..|.:|. .....|..|||
Human   180 LQGVRVPLLDSRTCDGLYHVGADVPQAE---------------RIVLPGSLCAGYPQGHKDACQG 229

  Fly   223 DSGGPLALNNR----LIGVTSFVSSKGCE-KNAPAGFTRVTSYLDWIK 265
            ||||||.....    |:||.|:  .|||. .|.|..:|.|.:|..||:
Human   230 DSGGPLTCLQSGSWVLVGVVSW--GKGCALPNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 69/265 (26%)
Tryp_SPc 40..267 CDD:238113 70/267 (26%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.