DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG30286

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:248 Identity:66/248 - (26%)
Similarity:113/248 - (45%) Gaps:45/248 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 NKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYG------------ 96
            ::|..::.|:   :::...:|...|||:::.:.::||||||.:...::|:..|            
  Fly    39 HQAHISESPW---MAYLHKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNG 100

  Fly    97 -STVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL-------PAIA 152
             ..:..|...:..|:    .:|.||:.....:||.|:: ..||.:.|.|..|.|       |.|.
  Fly   101 SDCLPPSEDFEIDVA----FRHGGYSRTNRIHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIE 161

  Fly   153 SSYSTYAGQTAVASGWGRT-SDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINK 216
            ..:      ..||:||||: |:::..:..:::..:   :...||.||:... .....||| |...
  Fly   162 RLH------RLVATGWGRSPSEAANHILKSIRVTR---VNWGVCSKTYWVD-RRRDQICV-SHES 215

  Fly   217 KSTCQGDSGGPLALNNRLIGVTSF-----VSSKGCEKNAPAGFTRVTSYLDWI 264
            ..:|.||||||:....||.|...|     ||....|..:|:.||.|..::|||
  Fly   216 GVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 64/246 (26%)
Tryp_SPc 40..267 CDD:238113 66/248 (27%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 66/248 (27%)
Tryp_SPc 39..268 CDD:214473 64/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436203
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.