DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG30091

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:275 Identity:68/275 - (24%)
Similarity:109/275 - (39%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVL 79
            ||.:|.:|..|   ....:|.|.|    |..|...:.|:   ::...:...:.||||:|.|.:||
  Fly    19 SARLLDEDCGV---PMQLIPKIVG----GVDAGELKNPW---MALIKTNDEFICGGSVITNKFVL 73

  Fly    80 TAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATL-----------RNDISLIK 133
            |||||........:.|.....|........:......|..||...:           ||||:|::
  Fly    74 TAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNHPHEIYNVERVYIHDSFAIQNYRNDIALLR 138

  Fly   134 -TPSVTFTVSINKIAL-------PAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVI 190
             ..|:.:...|..:.:       |      .|...|...|.|||.|.:..  ::.|||..:...|
  Fly   139 LQKSIVYKPQIKPLCILLNDQLKP------QTDLIQEFTAIGWGVTGNGK--MSNNLQMVKIYRI 195

  Fly   191 TNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNRLIGVTSF----VSSKGCEKNAP 251
            ...:|:..|..: ....:.|..:...:.||:.||||||.::....|:...    :.|.|.|....
  Fly   196 DRKMCEAAFWYT-FDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRG 259

  Fly   252 AG-FTRVTSYLDWIK 265
            .| :|.|..::|:|:
  Fly   260 FGMYTDVMGHIDFIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 59/248 (24%)
Tryp_SPc 40..267 CDD:238113 60/250 (24%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 61/252 (24%)
Tryp_SPc 37..276 CDD:238113 62/254 (24%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436209
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.