DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG30090

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:286 Identity:78/286 - (27%)
Similarity:121/286 - (42%) Gaps:41/286 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWW 67
            :.|:..|||..:.:  |.....:.||......:|..:|..|..|..|..|:   :::..|:....
  Fly     5 IAAITALAIGVLCS--LGNGEYLEPRCGLTANTIAFKIIGGRDAIINSNPW---MAYIHSSVKLI 64

  Fly    68 CGGSIIANTWVLTAAHCTKGASSVTIYYG-----STVRTSAKL----KKKVSSSKFVQHAGYNAA 123
            |||::|...:|||||||....|:|.:..|     :|...::|:    .::.......:|..::..
  Fly    65 CGGTLITQRFVLTAAHCVNEGSAVKVRLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEI 129

  Fly   124 TLRNDISLIKTPS-VTFTVSINKIAL------PAIASSYSTYAGQTAVASGWGRTSDSSIAVATN 181
            ...|||:|::... |||...|:.|.:      ..:..|...:     ||:|||.|........  
  Fly   130 KNLNDIALLRLAKFVTFKAHISPICIILGTSKRELVDSIEWF-----VATGWGETRTHRTRGV-- 187

  Fly   182 LQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNNR--------LIGVT 238
            ||..|.|...::.|.:..| .:|....||...:. ..||.|||||||....|        ..||.
  Fly   188 LQITQLQRYNSSQCMQALG-RLVQQNQICAGRLG-SDTCNGDSGGPLFQTVRHMDKMRPVQFGVV 250

  Fly   239 SFVSSKGCEKNAPAGFTRVTSYLDWI 264
            |: .|:.|  :....:|.|.||.|||
  Fly   251 SY-GSREC--SGIGVYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/248 (27%)
Tryp_SPc 40..267 CDD:238113 70/249 (28%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 68/248 (27%)
Tryp_SPc 40..276 CDD:238113 70/249 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.