DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG30088

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:252 Identity:73/252 - (28%)
Similarity:111/252 - (44%) Gaps:47/252 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTK-------GASSVT---I 93
            ||..|.:|.....|:...|.:.|..   .|||:||::.::||||||.:       |...:|   .
  Fly    44 RIVRGKEAMLKSAPFMAYLYYSSEI---HCGGTIISSRYILTAAHCMRPYLKVRLGEHDITRNPD 105

  Fly    94 YYGSTVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIAL---PAIASS 154
            ..|.:....|:....|.::|:.:...:    |.|||:|:| :.::.|.|.|..|.|   ||.|.:
  Fly   106 CQGGSCSPPAEEFDIVLATKYKRFDRF----LANDIALLKLSRNIRFNVHIQPICLILNPAAAPN 166

  Fly   155 YSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVIT---NAVCQKTFGSSVVTSGVICVESINK 216
            ...:.     |.|||:|..:..|     ...|..|:|   |..|:... |..:|...:|| ....
  Fly   167 VHEFQ-----AFGWGQTETNHSA-----NVLQTTVLTRYDNRHCRSVL-SMPITINQLCV-GFQG 219

  Fly   217 KSTCQGDSGGPLALNNRL--------IGVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265
            ..||.|||||||......        :|:.||...| |:  :|..:|.|.:|:.||:
  Fly   220 SDTCSGDSGGPLVTKVNYDGVWRYLQLGIVSFGDDK-CQ--SPGVYTYVPNYIRWIR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/249 (29%)
Tryp_SPc 40..267 CDD:238113 72/251 (29%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 71/249 (29%)
Tryp_SPc 45..273 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.