DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Cela2a

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036685.1 Gene:Cela2a / 24332 RGDID:2548 Length:271 Species:Rattus norvegicus


Alignment Length:246 Identity:92/246 - (37%)
Similarity:129/246 - (52%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSW--WCGGSIIANTWVLTAAHCTKGASSVTIYYG-STVR 100
            |:..|.:|:.|.:|:||.|.:.|| |.|  .||||::||.||||||||...:.:..:..| .::.
  Rat    30 RVVGGQEASPNSWPWQVSLQYLSS-GKWHHTCGGSLVANNWVLTAAHCISNSRTYRVLLGRHSLS 93

  Fly   101 TSAKLKKKVSSSKFVQHAGYNAATLR--NDISLIKTPS-VTFTVSINKIALP----AIASSYSTY 158
            ||......|..||.|.|..:||..|.  |||:|:|..| |..|..|....||    .:.::|..|
  Rat    94 TSESGSLAVQVSKLVVHEKWNAQKLSNGNDIALVKLASPVALTSKIQTACLPPAGTILPNNYPCY 158

  Fly   159 AGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKT--FGSSVVTSGVICVESINKKSTCQ 221
                  .:||||...:. |....||..:..|:..|.|...  :||||.|: ::|.......|:|.
  Rat   159 ------VTGWGRLQTNG-ATPDVLQQGRLLVVDYATCSSASWWGSSVKTN-MVCAGGDGVTSSCN 215

  Fly   222 GDSGGPL---ALNN--RLIGVTSFVSSKGCE-KNAPAGFTRVTSYLDWIKN 266
            |||||||   |.|.  ::.|:.||.|:.||. ...|:.||||::|:|||.:
  Rat   216 GDSGGPLNCQASNGQWQVHGIVSFGSTLGCNYPRKPSVFTRVSNYIDWINS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 90/242 (37%)
Tryp_SPc 40..267 CDD:238113 91/245 (37%)
Cela2aNP_036685.1 Tryp_SPc 30..264 CDD:214473 90/242 (37%)
Tryp_SPc 31..267 CDD:238113 91/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.