DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Ctrb1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:278 Identity:85/278 - (30%)
Similarity:135/278 - (48%) Gaps:39/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLVLAIATVSADILRQDTPVHPRDSSAVPSID------GRITNGNKAAANQFPYQVGLSFKSS 62
            |..||...|.|.|..           ...||:|.      .||.||..|....:|:||.|..|: 
  Rat     3 FLWLVSCFALVGATF-----------GCGVPTIQPVLTGLSRIVNGEDAIPGSWPWQVSLQDKT- 55

  Fly    63 AGSWWCGGSIIANTWVLTAAHCTKGASSVTIY----YGSTVRTSAKLKKKVSSSKFVQHAGYNAA 123
             |..:||||:|:..||:|||||....|.|.:.    .||.......||    .::..::..:|..
  Rat    56 -GFHFCGGSLISEDWVVTAAHCGVKTSDVVVAGEFDQGSDEENIQVLK----IAQVFKNPKFNMF 115

  Fly   124 TLRNDISLIK--TPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQ 186
            |:||||:|:|  ||: .|:.:::.:.||.:...:.  .|.....:|||:|..:::.....||.|.
  Rat   116 TVRNDITLLKLATPA-QFSETVSAVCLPNVDDDFP--PGTVCATTGWGKTKYNALKTPEKLQQAA 177

  Fly   187 FQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALNN----RLIGVTSFVSSKGCE 247
            ..:::.|.|:|::||.:  :.|:.....:..|:|.|||||||....    .|.|:.|: .|..|.
  Rat   178 LPIVSEADCKKSWGSKI--TDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSW-GSGVCS 239

  Fly   248 KNAPAGFTRVTSYLDWIK 265
            .:.||.::|||:.:.|::
  Rat   240 TSTPAVYSRVTALMPWVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 75/234 (32%)
Tryp_SPc 40..267 CDD:238113 75/236 (32%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 75/234 (32%)
Tryp_SPc 34..259 CDD:238113 75/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.