DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and try-5

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:245 Identity:58/245 - (23%)
Similarity:92/245 - (37%) Gaps:59/245 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PYQVGLSFKSSAGSW--WCGGSIIANTWVLTAAHCTK---GA-------SSVTIYY--------G 96
            |:.|.:..|:..|.:  .|||::|....|||||||.:   ||       :|::..|        .
 Worm    55 PWAVQIRVKARKGDFEVICGGTLITLKHVLTAAHCFQKHFGAKKEGGEENSMSGRYCESNQRFTD 119

  Fly    97 STVRTSAKLKKKVSSSKFVQHAG-----YNAATLR-----------------NDISLIKTPSVTF 139
            |.:.|...:......::..|..|     .|..||:                 |||.:::..|...
 Worm   120 SEILTRTVVTVGAMCTRLEQKYGCVNEKQNGKTLKISRFAIGDFYKTHCEQGNDIVILELESTID 184

  Fly   140 TV-SINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVI-----TNAVCQKT 198
            .| ..|...||.: ...:..:|....:.|||.......   .|..:...||:     |.|.|::.
 Worm   185 DVEGANYACLPFL-PEVNIQSGANVTSFGWGSDPGKGF---DNAAFPMIQVLTLATETLATCEEN 245

  Fly   199 FGSSVVTSGVICVESINKKSTCQGDSGGPLALNNR------LIGVTSFVS 242
            :|:|:.... .|......|:.|.|||||.|..:..      :|.:.|:.|
 Worm   246 WGTSIPFDS-FCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 58/245 (24%)
Tryp_SPc 40..267 CDD:238113 58/245 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.