DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CTSG

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_011534801.1 Gene:CTSG / 1511 HGNCID:2532 Length:269 Species:Homo sapiens


Alignment Length:242 Identity:73/242 - (30%)
Similarity:120/242 - (49%) Gaps:21/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 SAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYY 95
            ||...:.|.|..|.::..:..||...|..:|.||...|||.::...:|||||||  ..|::.:..
Human    26 SAKCFLPGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHC--WGSNINVTL 88

  Fly    96 GS-TVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTY 158
            |: .::.....::.:::.:.::|..||..|::|||.|:: :..|....::|.:|||  .:.....
Human    89 GAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALP--RAQEGLR 151

  Fly   159 AGQTAVASGWGRTS-----DSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKS 218
            .|.....:||||.|     |:       |:..|.:|..:..|.:.|||......:...:...:|:
Human   152 PGTLCTVAGWGRVSMRRGTDT-------LREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKA 209

  Fly   219 TCQGDSGGPLALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265
            ..:|||||||..||...|:.|:..|.|.   .|..||||:|:|.||:
Human   210 AFKGDSGGPLLCNNVAHGIVSYGKSSGV---PPEVFTRVSSFLPWIR 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 68/231 (29%)
Tryp_SPc 40..267 CDD:238113 70/233 (30%)
CTSGXP_011534801.1 Tryp_SPc 34..252 CDD:214473 68/231 (29%)
Tryp_SPc 35..255 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6099
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.