DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CTRL

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:239 Identity:86/239 - (35%)
Similarity:130/239 - (54%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGSTV 99
            |...||.||..|....:|:||  |.:.|:|..:||||:|:.:||:|||||........:..|...
Human    29 SFSQRIVNGENAVLGSWPWQV--SLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYD 91

  Fly   100 RTS-AKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPS-VTFTVSINKIALPAIASSYSTYAGQT 162
            |:| |:..:.:|.|:.:.|..:|:.|:.||::|:|..| ..:|..|:.:.|  .:|:.:...|.|
Human    92 RSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCL--ASSNEALTEGLT 154

  Fly   163 AVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGP 227
            .|.:||||.|........:||.....::|...|::.:||| :|..:||..... .|:||||||||
Human   155 CVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSS-ITDSMICAGGAG-ASSCQGDSGGP 217

  Fly   228 LALNNR----LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQ 267
            |.....    |||:.|: .:|.|...|||.:|||:.:..|| ||
Human   218 LVCQKGNTWVLIGIVSW-GTKNCNVRAPAVYTRVSKFSTWI-NQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 81/230 (35%)
Tryp_SPc 40..267 CDD:238113 82/232 (35%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.