DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG43742

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:277 Identity:72/277 - (25%)
Similarity:126/277 - (45%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWC 68
            |::|::|:      ::.|:......|.:....|..|:.||:.|..:||   :...:.:|  .::|
  Fly     5 FSLLLVAV------VIYQNAFAQLLDENCKVKITYRVANGHTAITSQF---MAALYNNS--EFFC 58

  Fly    69 GGSIIANTWVLTAAHCTKGASSVTIYYGSTVRT-SAKLKKKV--SSSKFVQHAGYNAATLRNDIS 130
            |||:|...:|||||||.:....||::.|...|: ...:.|.|  .::|.:.|..::.....|||:
  Fly    59 GGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIA 123

  Fly   131 LIKTP-SVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAV 194
            |::.. .|.|...|..|.: .:....::.......|.|||:|...:|:..  |.:.....:..::
  Fly   124 LLRLEREVIFEAHIRPICI-ILDEDVTSNNQNNFTAYGWGKTEHGNISDV--LSFIDLVRLPKSM 185

  Fly   195 CQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLALN--------NRLIGVTSFVSSKGCEKNAP 251
            |.:...:       ||..| ....||:.||||||..|        :.|.|:||:..:: |     
  Fly   186 CYQNINT-------ICAGS-TSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAE-C----- 236

  Fly   252 AG----FTRVTSYLDWI 264
            :|    :|.|.:|..||
  Fly   237 SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 64/240 (27%)
Tryp_SPc 40..267 CDD:238113 65/241 (27%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 64/240 (27%)
Tryp_SPc 35..256 CDD:238113 65/241 (27%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436210
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.