DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Cela2a

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:248 Identity:89/248 - (35%)
Similarity:127/248 - (51%) Gaps:31/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGNKAAANQFPYQVGLSFKSSAGSWW--CGGSIIANTWVLTAAHCTKGASSVTIYYGS-TVR 100
            |:..|.:|..|.:|:||.|...|| |.|.  ||||::||.||||||||.....:..:..|: ::.
Mouse    30 RVVGGQEATPNTWPWQVSLQVLSS-GRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLS 93

  Fly   101 TSAKLKKKVSSSKFVQHAGYNAATLRN--DISLIKTPS-VTFTVSINKIALP----AIASSYSTY 158
            ........|..||.|.|..:|:..:.|  ||:|||..| ||.:.:|....||    .:..:|..|
Mouse    94 NPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCY 158

  Fly   159 AGQTAVASGWG--RTSDSSIAVATNLQYAQFQVITNAVCQKT--FGSSVVTSGVICVESINKKST 219
                  .:|||  :|:.:|   ...|:..:..|:..|.|...  :||| |.|.::|.......|:
Mouse   159 ------VTGWGLLQTNGNS---PDTLRQGRLLVVDYATCSSASWWGSS-VKSSMVCAGGDGVTSS 213

  Fly   220 CQGDSGGPL---ALNN--RLIGVTSFVSSKGCE-KNAPAGFTRVTSYLDWIKN 266
            |.|||||||   |.|.  ::.|:.||.||.||. ...|:.||||::|:|||.:
Mouse   214 CNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 87/244 (36%)
Tryp_SPc 40..267 CDD:238113 88/247 (36%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 87/244 (36%)
Tryp_SPc 31..267 CDD:238113 88/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.