DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Ctsg

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_031826.1 Gene:Ctsg / 13035 MGIID:88563 Length:261 Species:Mus musculus


Alignment Length:232 Identity:76/232 - (32%)
Similarity:119/232 - (51%) Gaps:15/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIYYGS-TVRT 101
            |:|..|.:|..:.:||...|..:|..|...|||.::...:|||||||.  .||:.:..|: .::.
Mouse    19 GKIIGGREARPHSYPYMAFLLIQSPEGLSACGGFLVREDFVLTAAHCL--GSSINVTLGAHNIQM 81

  Fly   102 SAKLKKKVSSSKFVQHAGYNAATLRNDISLIK-TPSVTFTVSINKIALPAIASSYSTYAGQTAVA 165
            ..:.::.::..:.::|..||...:||||.|:: ......:.|:..:|||  .:|.....|.....
Mouse    82 RERTQQLITVLRAIRHPDYNPQNIRNDIMLLQLRRRARRSGSVKPVALP--QASKKLQPGDLCTV 144

  Fly   166 SGWGRTSDSSIAVATN-LQYAQFQVITNAVCQKTFGSSVVTSGVICV-ESINKKSTCQGDSGGPL 228
            :||||.|.|.   .|| ||..|.:|..:.:|...| ....:...||| ....:||..:|||||||
Mouse   145 AGWGRVSQSR---GTNVLQEVQLRVQMDQMCANRF-QFYNSQTQICVGNPRERKSAFRGDSGGPL 205

  Fly   229 ALNNRLIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIK 265
            ..:|...|:.|:.|:.|   |.||.||::.|::.|||
Mouse   206 VCSNVAQGIVSYGSNNG---NPPAVFTKIQSFMPWIK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 72/228 (32%)
Tryp_SPc 40..267 CDD:238113 75/230 (33%)
CtsgNP_031826.1 Tryp_SPc 20..238 CDD:214473 72/228 (32%)
Tryp_SPc 21..241 CDD:238113 75/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6099
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.