DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and CG43336

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:261 Identity:70/261 - (26%)
Similarity:115/261 - (44%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHCTKGASSVTIY 94
            |.:||    |:.||..|:....|:...|  .|:.|.:.||||:|.|..|||||||....:.:...
  Fly    32 SPSVP----RVKNGTVASLTSSPWMAFL--HSTDGRFICGGSLITNRLVLTAAHCFLDRTELVAR 90

  Fly    95 YGS--------------TVRTSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKT-PSVTFTVSIN 144
            .|.              |.|..|.:::.      .:|..||..|:..||::::. ..|.:|.:|.
  Fly    91 LGEYDREEYEMCHDSYCTYRIEAMVERG------FRHRHYNPMTMAYDIAILRLYRKVQYTDNIR 149

  Fly   145 KIALPAIASSYSTYAG--QTAVASGWGRT-SDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTS 206
            .|.: .|...:..|..  .....:|||:| |:...|....:..|:..   ..||:: :.:..:|:
  Fly   150 PICI-VIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKLRTVDLARKH---PEVCRR-YATLSLTA 209

  Fly   207 GVICVESINKKSTCQGDSGGPLAL------NNRL--IGVTSFVSSKGCEKNAPAGFTRVTSYLDW 263
            ...|..: .:.:.|.||||||:..      :.|.  :|:.||.:::....:.   ||.|.||:||
  Fly   210 NQFCAGN-ERSNLCNGDSGGPVGALIPYGKSKRFVQVGIASFTNTQCVMVSV---FTDVMSYVDW 270

  Fly   264 I 264
            |
  Fly   271 I 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 65/250 (26%)
Tryp_SPc 40..267 CDD:238113 66/251 (26%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 65/250 (26%)
Tryp_SPc 40..271 CDD:238113 64/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.