DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Cela1

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_291090.2 Gene:Cela1 / 109901 MGIID:95314 Length:266 Species:Mus musculus


Alignment Length:287 Identity:94/287 - (32%)
Similarity:137/287 - (47%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGSW- 66
            |||.|||.                ...:..||..|.|:..|.:|..|.:|.|:.|.:: ..||| 
Mouse     6 VFASLVLC----------------GHSTEDVPETDARVVGGAEARRNSWPSQISLQYQ-YGGSWH 53

  Fly    67 -WCGGSIIANTWVLTAAHCTKGASSVTIYYGS-TVRTSAKLKKKVSSSKFVQH---------AGY 120
             .|||::|.:.||:|||||.....:..:..|. .:..:...::.|:..|.|.|         |||
Mouse    54 HTCGGTLIRSNWVMTAAHCVDSPMTYRVVVGEHNLSQNDGTEQYVNVQKIVSHPYWNKNNVVAGY 118

  Fly   121 NAATLRNDISLIKTPSVTFTVSINKIALP----AIASSYSTYAGQTAVASGWGRTSDSSIAVATN 181
            :.|.||    |.|  |||....:....||    .:|::...|      .:|||||..:. .:|..
Mouse   119 DIALLR----LAK--SVTLNNYVQLGVLPREGTILANNSPCY------ITGWGRTRTNG-ELAQT 170

  Fly   182 LQYAQFQVITNAVCQKT--FGSSVVTSGVICVESINKKSTCQGDSGGPL--ALNNR--LIGVTSF 240
            ||.|....::.::|..:  :||||..: ::|......:|.|||||||||  .:|.:  :.|||||
Mouse   171 LQQAYLPSVSYSICSSSSYWGSSVKNT-MVCAGGDGVRSGCQGDSGGPLHCMVNGQYAVHGVTSF 234

  Fly   241 VSSKGCE-KNAPAGFTRVTSYLDWIKN 266
            |||.||. ...|..||||::|:.|:.|
Mouse   235 VSSMGCNVARKPTVFTRVSAYISWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 83/247 (34%)
Tryp_SPc 40..267 CDD:238113 84/250 (34%)
Cela1NP_291090.2 Tryp_SPc 26..258 CDD:214473 83/246 (34%)
Tryp_SPc 27..262 CDD:238113 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.