DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and Ctrl

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:135/249 - (54%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VPSI------DGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAAHC--TKGAS 89
            ||:|      :.||.||..|....:|:||  |.:.:.|..:||||:|:..||:|||||  |.|..
Mouse    21 VPAITPALSYNQRIVNGENAVPGSWPWQV--SLQDNTGFHFCGGSLISPNWVVTAAHCQVTPGRH 83

  Fly    90 SVTIYYGSTVRTS-AKLKKKVSSSKFVQHAGYNAATLRNDISLIKTPS-VTFTVSINKIALPAIA 152
            .|.:  |...|:| |:..:.:|.::.:.|..:||.|:.||::|:|..| ..:|..::.:.|  .:
Mouse    84 FVVL--GEYDRSSNAEPVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCL--AS 144

  Fly   153 SSYSTYAGQTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINKK 217
            ::.:..:|.|.|.:||||.|.........||.....::|...|::.:|:. :|..:||... :..
Mouse   145 TNEALPSGLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGAR-ITDAMICAGG-SGA 207

  Fly   218 STCQGDSGGPLALNNR----LIGVTSFVSSKGCEKNAPAGFTRVTSYLDWIKNQ 267
            |:|||||||||.....    |||:.|: .:|.|...|||.:|||:.:..|| ||
Mouse   208 SSCQGDSGGPLVCQKGNTWVLIGIVSW-GTKNCNIQAPAMYTRVSKFSTWI-NQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 79/232 (34%)
Tryp_SPc 40..267 CDD:238113 80/234 (34%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 79/232 (34%)
Tryp_SPc 34..260 CDD:238113 82/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.