DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and cela1.2

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:287 Identity:83/287 - (28%)
Similarity:134/287 - (46%) Gaps:49/287 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGLSFKSSAGS 65
            :.|.|.|.||......||                :|:.|:..|..|..:.:|:|:.|.: |..|:
Zfish     7 LSVLATLALAEPRYLKDI----------------AIEERVVGGEIAKPHSWPWQISLQY-SDLGT 54

  Fly    66 --WWCGGSIIANTWVLTAAHCTKGASSVTIYYGS-TVRTSAKLKKKVSSSKFVQHAGYNAATLRN 127
              ::|.|::|...||:.||||.:.....|:..|. .:.|....::.:|.|:...|..:|.    |
Zfish    55 YYYYCSGTLIRPGWVMVAAHCVEALRKWTVALGDHDIYTHEGPEQYISVSEVFIHPNWNP----N 115

  Fly   128 DISLIKTPSVTFTVSINKIALPAIASSYSTYA-----------GQTAVASGWGRTSDSSIAVATN 181
            :::.      .:.:::.::::.|..|||...|           |.|...:|||.| ::..:::..
Zfish   116 NVAF------GYDIALLRLSIDATLSSYVQVATLPSSGEILPYGHTCYITGWGYT-ETGGSLSAQ 173

  Fly   182 LQYAQFQVITNAVC-QKTFGSSVVTSGVICVESINKKSTCQGDSGGPL--ALNNRLI--GVTSFV 241
            |:.|...|:....| ||.:..|.|...:||.......|.|.||||.||  ..|.:.:  ||||||
Zfish   174 LKQAYMPVVDYETCSQKDWWGSSVKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVHGVTSFV 238

  Fly   242 SSKGCEK-NAPAGFTRVTSYLDWIKNQ 267
            |.:||.. ..|.|||||::|::|| ||
Zfish   239 SPEGCNTYKKPTGFTRVSAYINWI-NQ 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 71/244 (29%)
Tryp_SPc 40..267 CDD:238113 72/246 (29%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 71/244 (29%)
Tryp_SPc 30..265 CDD:238113 74/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.