DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and f7l

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:266 Identity:78/266 - (29%)
Similarity:129/266 - (48%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VHPRDSSAVPSID------------GRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTW 77
            :|..:||.||:.|            .||..|:.....|.|:|..|.:.   |.:.|||.|:.:.|
Zfish   168 LHSDNSSCVPTADFSCGRPVAKGVGPRIVKGDVCPKGQCPWQALLEYD---GQYKCGGVILNSQW 229

  Fly    78 VLTAAHC--TKGASSVTIYYGSTVR---TSAKLKKKVSSSKFVQHAGYNAATLRNDISLIKT-PS 136
            ::|||||  .|..:.:.:..|..:|   ...:..:||  |:...|..||.::..:|::|::. ..
Zfish   230 IITAAHCIWRKDPALLQVIVGEHIRDRDEGTEQMRKV--SEVFLHPQYNHSSTDSDVALLRLHRP 292

  Fly   137 VTFTVSINKIALPAIASSYS-TYAG-QTAVASGWGRTSDSSIAVATNLQYAQFQVITNAVCQKTF 199
            ||.......:.||....::| |.|. :.:..|||||.:.|. ..:|.||..|...:::..|:...
Zfish   293 VTLGPYALPVCLPPPNGTFSRTLASIRMSTVSGWGRLAQSG-PPSTVLQRLQVPRVSSEDCRARS 356

  Fly   200 GSSVVTSGVICVE-SINKKSTCQGDSGGPLALNNR----LIGVTSFVSSKGCEKNAPAG-FTRVT 258
            |.: |:..::|.. :...:.:|||||||||....|    |.|:.|:  .|||.:....| :|||:
Zfish   357 GLT-VSRNMLCAGFAEGGRDSCQGDSGGPLVTRYRNTWFLTGIVSW--GKGCARADVYGIYTRVS 418

  Fly   259 SYLDWI 264
            .:::||
Zfish   419 VFVEWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 70/238 (29%)
Tryp_SPc 40..267 CDD:238113 71/239 (30%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.