DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10477 and zgc:163079

DIOPT Version :9

Sequence 1:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:243 Identity:69/243 - (28%)
Similarity:120/243 - (49%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IDGRITNGNKAAANQFPYQVGLSFKSSAGSWWCGGSIIANTWVLTAA--HCTKGASSVTIYYGST 98
            ::.:|..|..|....:|:|..::.|::. .::||||:|...||||.|  .....||.:.:|.|..
Zfish    32 LNTKIIGGLNATQGSWPWQASINLKATE-EFYCGGSLINKGWVLTTAKVFALMPASDIVVYLGRQ 95

  Fly    99 VRTSA---KLKKKVSSSKFVQHAGYNAATLRNDISLIKTPS-VTFTVSINKIALPAIASSYSTYA 159
            .:..:   ::.:.|  :|.::|..||  :|.::::|:|..| |||:..|..:.|.|..|.:  ..
Zfish    96 TQNGSNPYEISRTV--TKIIKHPNYN--SLDSNLALLKLSSPVTFSDYIKPVCLAAAGSVF--VD 154

  Fly   160 GQTAVASGWG----RTSDSSIAVATNLQYAQFQVITNAVCQKTFGSSVVTSGVICVESINK--KS 218
            |..:..:|||    ..:...|.:...||..:..::.|..|...:| .::|:.::|...:|:  |:
Zfish   155 GTASWVTGWGYLNRPATVEEIMLPDVLQEVEAPIVNNFECNAAYG-GIITNKLLCAGYLNEDGKA 218

  Fly   219 TCQGDSGGPLALNNRLIGVTSFVSSKG-CE-KNAPAGFTRVTSYLDWI 264
            .|.||.||||.:....|.:.|.|...| |. ...|..:.||:.|.|||
Zfish   219 PCAGDVGGPLVIKQGAIWIQSGVVVSGYCGLPGYPTIYVRVSEYEDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 67/238 (28%)
Tryp_SPc 40..267 CDD:238113 69/239 (29%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 67/238 (28%)
Tryp_SPc 36..267 CDD:238113 69/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.